Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium tuberculosis Cell surface glycolipoprotein MPT83 (mpt83)

This Recombinant Mycobacterium tuberculosis Cell surface glycolipoprotein MPT83 (mpt83) spans the amino acid sequence from region 25-220aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lipoprotein p23

UniProt

P9WNF3

Expression Region

25-220aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parecoxib Sodium Impurity 74
RM-P186076-01 10 mg

Parecoxib Sodium Impurity 74

Sign In for Pricing
View Details
Parecoxib Sodium Impurity 74
RM-P186076-02 25 mg

Parecoxib Sodium Impurity 74

Sign In for Pricing
View Details
Parecoxib Sodium Impurity 74
RM-P186076-03 50 mg

Parecoxib Sodium Impurity 74

Sign In for Pricing
View Details
Parecoxib Sodium Impurity 74
RM-P186076-04 100 mg

Parecoxib Sodium Impurity 74

Sign In for Pricing
View Details
RNF31 Rabbit pAb (APR20692N)
APR20692N-01 50 µL

RNF31 Rabbit pAb (APR20692N)

Sign In for Pricing
View Details
RNF31 Rabbit pAb (APR20692N)
APR20692N-02 100 µL

RNF31 Rabbit pAb (APR20692N)

Sign In for Pricing
View Details