Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Heparin-binding growth factor 2 (Fgf2)

This Recombinant Mouse Heparin-binding growth factor 2 (Fgf2) spans the amino acid sequence from region 10-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

UniProt

P15655

Expression Region

10-154aa

Tag

N-terminal 6xHis-tagged and C-terminal Avi-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Heat Shock 10kDa Protein 1 ELISA Kit
MBS079983 Inquire

Goose Heat Shock 10kDa Protein 1 ELISA Kit

Sign In for Pricing
View Details
Knudson C Modified Plus Orchid Medium
B2023099 1 L

Knudson C Modified Plus Orchid Medium

Sign In for Pricing
View Details
TIMM17A ORF Vector (Human) (pORF)
ORF010524 1.0 µg DNA

TIMM17A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Human pigment epithelium-derived factor (PEDF) ELISA Kit
201-12-1635 96 Tests

Human pigment epithelium-derived factor (PEDF) ELISA Kit

Sign In for Pricing
View Details
UBE2I Antibody
OAEB02456-100UG 100 µg

UBE2I Antibody

Sign In for Pricing
View Details
Mouse Negative elongation factor D, Th1l ELISA KIT
ELI-42483m 96 Tests

Mouse Negative elongation factor D, Th1l ELISA KIT

Sign In for Pricing
View Details