Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Heparin-binding growth factor 2 (Fgf2)

This Recombinant Mouse Heparin-binding growth factor 2 (Fgf2) spans the amino acid sequence from region 10-154aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

UniProt

P15655

Expression Region

10-154aa

Tag

N-terminal 6xHis-tagged and C-terminal Avi-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELSR1 Antibody : FITC (OAAF02888-FITC)
OAAF02888-100UG-FITC 100 µg

CELSR1 Antibody : FITC (OAAF02888-FITC)

Sign In for Pricing
View Details
AHI1 Protein Vector (Mouse) (pPM-C-HA)
PV153192 500 ng

AHI1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Efna1 (NM_010107) Mouse Tagged Lenti ORF Clone
MR226172L4 10 µg

Efna1 (NM_010107) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
COQ10B ORF Vector (Human) (pORF)
16641011 1.0 µg DNA

COQ10B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Gabrp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6961505 3x 1.0 µg

Gabrp sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
NT5C2, 1-561aa, Human, His tag E.coli
E53A03206 50 µg

NT5C2, 1-561aa, Human, His tag E.coli

Sign In for Pricing
View Details