Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb)
This Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb) spans the amino acid sequence from region 82-190aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PDGF subunit B; PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis
UniProt
P31240
Expression Region
82-190aa
Tag
C-terminal Avi-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
130133-ML650 100 µL
NANS (Sialic Acid Synthase, N-Acetylneuraminate Synthase, N-acetylneuraminic Acid Synthase, N-acetylneuraminate-9-phosphate Synthase, N-acetylneuraminic Acid Phosphate Synthase, SAS) (MaxLight 650)
Sign In for Pricing
View Details 
orb1666321-01 48 Tests
Mouse Forkhead Box Protein O3 (FOXO3) ELISA Kit
Sign In for Pricing
View Details orb1666321-02 96 Tests
Mouse Forkhead Box Protein O3 (FOXO3) ELISA Kit
Sign In for Pricing
View Details