Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant AKV murine leukemia virus Envelope glycoprotein (env), partial

This Recombinant AKV murine leukemia virus Envelope glycoprotein (env), partial spans the amino acid sequence from region 32-470aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Env polyprotein; SU; Glycoprotein 70; gp70; TM; Envelope protein p15E; p2E

UniProt

P03386

Expression Region

32-470aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

AKV murine leukemia virus (AKR (endogenous) murine leukemia virus)

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VTLGNSPHQVFNLTWEVTNGDRETVWAITGNHPLWTWWPDLTPDLCMLALHGPSYWGLEYRAPFSPPPGPPCCSGSSDSTPGCSRDCEEPLTSYTPRCNTAWNRLKLSKVTHAHNGGFYVCPGPHRPRWARSCGGPESFYCASWGCETTGRASWKPSSSWDYITVSNNLTSDQATPVCKGNEWCNSLTIRFTSFGKQATSWVTGHWWGLRLYVSGHDPGLIFGIRLKITDSGPRVPIGPNPVLSDRRPPSRPRPTRSPPPSNSTPTETPLTLPEPPPAGVENRLLNLVKGAYQALNLTSPDKTQECWLCLVSGPPYYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCIGAVPKTHQVLCNTTQKTSDGSYYLAAPTGTTWACSTGLTPCISTTILDLTTDYCVLVELWPRVTYHSPSYVYHQFERRAKYKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYLD Human Gene Knockout Kit (CRISPR)
KN204099LP 1 Kit

CYLD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ferritin Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-
I-5001-1 1 mg

Ferritin Conjugated Agaricus bisporus Lectin (Mushroom) -ABA-

Sign In for Pricing
View Details
Human PIIINP (N-Terminal Procollagen III Propeptide) CLIA Kit
E-CL-H0167-01 24 Tests

Human PIIINP (N-Terminal Procollagen III Propeptide) CLIA Kit

Sign In for Pricing
View Details
Human PIIINP (N-Terminal Procollagen III Propeptide) CLIA Kit
E-CL-H0167-02 48 Tests

Human PIIINP (N-Terminal Procollagen III Propeptide) CLIA Kit

Sign In for Pricing
View Details
Human PIIINP (N-Terminal Procollagen III Propeptide) CLIA Kit
E-CL-H0167-03 96 Tests

Human PIIINP (N-Terminal Procollagen III Propeptide) CLIA Kit

Sign In for Pricing
View Details
(R)-1-Aminoindane Hydrochloride
TRC-A611713-5G 5 g

(R)-1-Aminoindane Hydrochloride

Sign In for Pricing
View Details