Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ropporin-1A (ROPN1)

This Recombinant Human Ropporin-1A (ROPN1) spans the amino acid sequence from region 1-212aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 91; CT91; Rhophilin-associated protein 1A

UniProt

Q9HAT0

Expression Region

1-212aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNJ1 Adenovirus (Rat)
45975056 1.0 mL

SYNJ1 Adenovirus (Rat)

Sign In for Pricing
View Details
TCEAL7 Protein Vector (Human) (pPM-C-HA)
46334021 500 ng

TCEAL7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
ACTR1A (NM_005736) Human Over-expression Lysate
LS010121-20ug 20 µg

ACTR1A (NM_005736) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc22 ORF Vector (Mouse) (pORF)
ORF040574 1.0 µg DNA

Ccdc22 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Osteocalcin protein
30C-CP3015U 20 ug

Osteocalcin protein

Sign In for Pricing
View Details
rno-miR-448-5p Primers
MPR00699 150 µL / 10 µM

rno-miR-448-5p Primers

Sign In for Pricing
View Details