Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Fibroblast growth factor 2 (FGF2)

This Recombinant Chicken Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 13-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2

UniProt

P48800

Expression Region

13-158aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Gallus gallus (Chicken)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Lung PrimaCell™3: Normal Pulmonary Artery Fibroblasts Growth Supplements with Serum (for 500 mL medium)
9-47083 Set

Human Lung PrimaCell™3: Normal Pulmonary Artery Fibroblasts Growth Supplements with Serum (for 500 mL medium)

Sign In for Pricing
View Details
Rabbit Anti Human TENM3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120UL
IRBAMLTENM3AP00120UL 120 µL

Rabbit Anti Human TENM3 Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (IHC,ELISA) 120UL

Sign In for Pricing
View Details
NRXN3 siRNA (Human)
MBS8239898-01 15 nmol

NRXN3 siRNA (Human)

Sign In for Pricing
View Details
NRXN3 siRNA (Human)
MBS8239898-02 30 nmol

NRXN3 siRNA (Human)

Sign In for Pricing
View Details
NRXN3 siRNA (Human)
MBS8239898-03 5x 30 nmol

NRXN3 siRNA (Human)

Sign In for Pricing
View Details
SUPAR
orb420613 100 µg

SUPAR

Sign In for Pricing
View Details