Recombinant Chicken Fibroblast growth factor 2 (FGF2)
This Recombinant Chicken Fibroblast growth factor 2 (FGF2) spans the amino acid sequence from region 13-158aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2
UniProt
P48800
Expression Region
13-158aa
Tag
N-terminal 10xHis-tagged
Source
Baculovirus
Origin
Gallus gallus (Chicken)
Field of Research
Cardiovascular Research; Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
PALPDDGGGGAFPPGHFKDPKRLYCKNGGFFLRINPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRFLAMKEDGRLLALKCATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043193-500 1x 500 µL
Prohibitin (Mitochondrial Marker) (PHB/3193), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 