Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human IL-12 receptor beta component (IL12RB1), partial

This Recombinant Human IL-12 receptor beta component (IL12RB1), partial spans the amino acid sequence from region 25-239aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-12 receptor subunit beta-1; IL-12R subunit beta-1; IL-12R-beta-1; IL-12RB1; IL-12 receptor beta component; CD antigen CD212

UniProt

P42701

Expression Region

25-239aa

Tag

C-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp202 Mouse Gene Knockout Kit (CRISPR)
KN519748 1 Kit

Zfp202 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Isopentenyl Pyrophosphate Ammonium Salt Hydrate (>85%)
TRC-I821858-5MG 5 mg

Isopentenyl Pyrophosphate Ammonium Salt Hydrate (>85%)

Sign In for Pricing
View Details
IL27RA Polyclonal Antibody
E-AB-63002-01 60 µL

IL27RA Polyclonal Antibody

Sign In for Pricing
View Details
IL27RA Polyclonal Antibody
E-AB-63002-02 120 µL

IL27RA Polyclonal Antibody

Sign In for Pricing
View Details
IL27RA Polyclonal Antibody
E-AB-63002-03 200 µL

IL27RA Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 19 (A53-B/A2.26), CF640R conjugate, 0.1mg/mL
BNC400020-100 1x 100 µL

Cytokeratin 19 (A53-B/A2.26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details