Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), partial

This Recombinant Mouse Spectrin beta chain, non-erythrocytic 1 (Sptbn1), patial spans the amino acid sequence from region 2199-2304aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-II spectrin; Embryonic liver fodrin; Fodrin beta chain

UniProt

Q62261

Expression Region

2199-2304aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Svs2 Mouse shRNA Plasmid (Locus ID 53878)
TL512408 1 Kit

Svs2 Mouse shRNA Plasmid (Locus ID 53878)

Sign In for Pricing
View Details
PSMG1 (NM_003720) Human Tagged Lenti ORF Clone
RC200550L3 10 µg

PSMG1 (NM_003720) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti CBDV (cannabidivarin) Pab
111981 100 µg

Anti CBDV (cannabidivarin) Pab

Sign In for Pricing
View Details
Chicken Anti-Indian Cobra (Naja naja) antiserum
ICO12-S 100 µL

Chicken Anti-Indian Cobra (Naja naja) antiserum

Sign In for Pricing
View Details
Olfactory receptor 5M1/5M10 Rabbit Polyclonal Antibody
E28PT3412 100 µL

Olfactory receptor 5M1/5M10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal FBXO42 Antibody
NBP1-84711 0.1 mL

Rabbit Polyclonal FBXO42 Antibody

Sign In for Pricing
View Details