Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor Kazal-type 4 (Spink4)

This Recombinant Mouse Serine protease inhibitor Kazal-type 4 (Spink4) spans the amino acid sequence from region 27-86aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MPGC60 protein; Peptide PEC-60 homolog

UniProt

O35679

Expression Region

27-86aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pdgfrα (Platelet Derived Growth Factor Receptor Alpha) ELISA Kit
FY-EH3717 96 Well

Human Pdgfrα (Platelet Derived Growth Factor Receptor Alpha) ELISA Kit

Sign In for Pricing
View Details
GC Column, H3-225, 50m*0.32mm*0.5um, 1pc/pk
14051267 1 PC

GC Column, H3-225, 50m*0.32mm*0.5um, 1pc/pk

Sign In for Pricing
View Details
Lentiviral human TREM2 shRNA (UAS) - Lentiviral human TREM2 shRNA (UAS, iRFP) plasmid
GTR15084796 1 Vial

Lentiviral human TREM2 shRNA (UAS) - Lentiviral human TREM2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
LMO2 Lentiviral Activation Particles (m)
sc-421447-LAC 200 µL

LMO2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Catharanthine sulfate 50mg
A12161-50 50 mg

Catharanthine sulfate 50mg

Sign In for Pricing
View Details
Porcine Apolipoprotein B, APOB ELISA KIT
EA0036Po-01 96 Well

Porcine Apolipoprotein B, APOB ELISA KIT

Sign In for Pricing
View Details