Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG), Fluorescent-VLPs
This Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG) -VLPs, Fluorescent spans the amino acid sequence from region 30-247aa. Purity: The purity information is not available for VLPs proteins.
Product Specifications
UniProt
Q16653
Expression Region
30-247aa
Tag
C-terminal EGFP-tagged (This tag can be tested only under denaturing conditions)
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Purity
The purity information is not available for VLPs proteins.
Form
Lyophilized powder
Molecular Weight
55.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Preservative
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
AA Sequence
GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1148459 100 µg
Anti-Collagen V Alpha-1 Chain N-propeptide-NC2 domain Antibody
Sign In for Pricing
View Details 
DMAB3605 1 mg
Mouse Anti-Herpes Simplex Virus Type 2 Glycoprotein D Monoclonal Antibody
Sign In for Pricing
View Details