Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sclerostin (SOST), Biotinylated

This Recombinant Human Sclerostin (SOST), Biotinylated spans the amino acid sequence from region 24-213aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9BQB4

Expression Region

24-213aa

Tag

N-terminal 10xHis-tagged and C-terminal Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Isobutyl nitrate
sc-507135 5 mL

Isobutyl nitrate

Sign In for Pricing
View Details
CHR CRISPRa sgRNA lentivector (set of three targets)(Human)
16105121 3x 1.0µg DNA

CHR CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
ACVR1 Rabbit Polyclonal Antibody
E53P12625 100 µL

ACVR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Glutamate--tRNA ligase (gltX)
MBS1374831-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Glutamate--tRNA ligase (gltX)
MBS1374831-02 0.02 mg (Yeast)

Recombinant Pseudomonas putida Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Glutamate--tRNA ligase (gltX)
MBS1374831-03 0.1 mg (E-Coli)

Recombinant Pseudomonas putida Glutamate--tRNA ligase (gltX)

Sign In for Pricing
View Details