Recombinant Human Hepatic sodium/bile acid cotransporter (SLC10A1), partial, Biotinylated
This Recombinant Human Hepatic sodium/bile acid cotransporter (SLC10A1), partial, Biotinylated spans the amino acid sequence from region 304-349aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Cell growth-inhibiting gene 29 protein; Na+; Na+; Sodium/taurocholate cotransporting polypeptide; NTCP; Solute carrier family 10 member 1; SLC10A1
UniProt
Q14973
Expression Region
304-349aa
Tag
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Gastroenterology & Hepatology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
52.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#20287-1 1x 50 µL
CF®680 Goat Anti-Human IgG (H+L), Highly Cross-Adsorbed, 2mg/mL
Sign In for Pricing
View Details ![Mouse Monoclonal NKX2.2 Antibody (rNX2/1523) [DyLight 488]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP3-08567G 100 µL
Mouse Monoclonal NKX2.2 Antibody (rNX2/1523) [DyLight 488]
Sign In for Pricing
View Details 
48598126 3x 1.0µg DNA
TSPAN8 CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details OM626125 100 Tests
Micro Mitochondrial Respiratory Chain ComplexIIIActivity Assay Kit
Sign In for Pricing
View Details