Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transforming growth factor beta-1 proprotein (Tgfb1), partial

This Recombinant Mouse Transforming growth factor beta-1 (Tgfb1), partial spans the amino acid sequence from region 279-390aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAP; TGF-beta-1

UniProt

P04202

Expression Region

279-390aa

Tag

N-terminal 6xHis-tagged and C-terminal Avi-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NACA1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-11415 0.1 mg

NACA1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
NMBR CRISPRa sgRNA lentivector (set of three targets)(Mouse)
31937124 3x 1.0µg DNA

NMBR CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
NPHS2 Human Over-expression Lysate
orb1368436 20 µg

NPHS2 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-MRSA agent 3
orb1686408-01 25 mg

Anti-MRSA agent 3

Sign In for Pricing
View Details
Anti-MRSA agent 3
orb1686408-02 50 mg

Anti-MRSA agent 3

Sign In for Pricing
View Details
Anti-MRSA agent 3
orb1686408-03 100 mg

Anti-MRSA agent 3

Sign In for Pricing
View Details