Recombinant Human C-C motif chemokine 21 (CCL21)
This Recombinant Human C-C motif chemokine 21 (CCL21) spans the amino acid sequence from region 24-134aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
6Ckine; Beta-chemokine exodus-2; Secondary lymphoid-tissue chemokine; SLC; Small-inducible cytokine A21
UniProt
O00585
Expression Region
24-134aa
Tag
N-terminal 6xHis-GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
43.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1542104 1.0 µg DNA
OR7M1P sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details