Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131)

This Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131) spans the amino acid sequence from region 1-76aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P16773

Expression Region

1-76aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK5RAP1 Double Nickase Plasmid (m2)
sc-426299-NIC-2 20 µg

CDK5RAP1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Rabbit Polyclonal MED28 Antibody
NBP2-97494-50ul 50 µL

Rabbit Polyclonal MED28 Antibody

Sign In for Pricing
View Details
NRSF Recombinant Antibody, APC Conjugated
bsm-61633R-APC-01 20 µL

NRSF Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
NRSF Recombinant Antibody, APC Conjugated
bsm-61633R-APC-02 100 µL

NRSF Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
anti-PKNOX1.1
YF-PA13806 100 ug

anti-PKNOX1.1

Sign In for Pricing
View Details
Human Prostaglandin E2 ELISA Kit
DEIA2192 96T

Human Prostaglandin E2 ELISA Kit

Sign In for Pricing
View Details