Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131)

This Recombinant Human cytomegalovirus Uncharacterized protein UL131 (UL131) spans the amino acid sequence from region 1-76aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P16773

Expression Region

1-76aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCMMSHNKAFFLSLQHAAVSGVAVCLSVRRGAGSVPAGNRGKKTIITEYRITGTRALARCPTKPVTSMWNSSWTSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBR1 Protein Vector (Rat) (pPM-C-HA)
PV310004 500 ng

TBR1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TADA2L Rabbit Polyclonal Antibody (HRP)
orb2129675 100 µL

TADA2L Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Rabbit PLASMA in Sodium Citrate
OORA01513-50ML 50 mL

Rabbit PLASMA in Sodium Citrate

Sign In for Pricing
View Details
Hydroxytolbutamide-d9 (N- (Butylamnocarbonyl) -4-hydroxymethylbenzenesulfonamide-d9)
H9117-95C 1 mg

Hydroxytolbutamide-d9 (N- (Butylamnocarbonyl) -4-hydroxymethylbenzenesulfonamide-d9)

Sign In for Pricing
View Details
Mrps24 (NM_001077659) Rat Tagged ORF Clone Lentiviral Particle
RR211142L4V 200 µL

Mrps24 (NM_001077659) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3110009E18Rik (NM_001172074) Mouse Tagged ORF Clone
MR215250 10 µg

3110009E18Rik (NM_001172074) Mouse Tagged ORF Clone

Sign In for Pricing
View Details