Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3), partial

This Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3), partial spans the amino acid sequence from region 26-287aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen DNase; LS-DNase; LSD

UniProt

O55070

Expression Region

26-287aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IBtk Lentiviral Activation Particles (m2)
sc-430863-LAC-2 200 µL

IBtk Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Phospho-HSP70 (Tyr611) Rabbit Polyclonal Antibody (APC-Cy7)
orb1607827 100 µL

Phospho-HSP70 (Tyr611) Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Canine Neuronal apoptosis inhibitory protein ELISA Kit
MBS754934-01 48 Well

Canine Neuronal apoptosis inhibitory protein ELISA Kit

Sign In for Pricing
View Details
Canine Neuronal apoptosis inhibitory protein ELISA Kit
MBS754934-02 96 Well

Canine Neuronal apoptosis inhibitory protein ELISA Kit

Sign In for Pricing
View Details
Canine Neuronal apoptosis inhibitory protein ELISA Kit
MBS754934-03 5x 96 Well

Canine Neuronal apoptosis inhibitory protein ELISA Kit

Sign In for Pricing
View Details
Canine Neuronal apoptosis inhibitory protein ELISA Kit
MBS754934-04 10x 96 Well

Canine Neuronal apoptosis inhibitory protein ELISA Kit

Sign In for Pricing
View Details