Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3), partial

This Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3), partial spans the amino acid sequence from region 26-287aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen DNase; LS-DNase; LSD

UniProt

O55070

Expression Region

26-287aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKG (NM_001080744) Human Recombinant Protein
TP324710L 1 mg

DGKG (NM_001080744) Human Recombinant Protein

Sign In for Pricing
View Details
Neurabin 2 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-12146R-APC-Cy5.5 100 µL

Neurabin 2 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
IFluor® 514 Anti-human CD18 Antibody *HI18a*
10180061-AAT 500 Tests

IFluor® 514 Anti-human CD18 Antibody *HI18a*

Sign In for Pricing
View Details
PLA2G7, ID (PLA2G7, PAFAH, Platelet-activating factor acetylhydrolase, 1-alkyl-2-acetylglycerophosphocholine esterase, 2-acetyl-1-alkylglycerophosphocholine esterase, Group-VIIA phospholipase A2, LDL-associated phospholipase A2, PAF 2-acylhydrolase) (AP) discontinued
040122-AP 200 µL

PLA2G7, ID (PLA2G7, PAFAH, Platelet-activating factor acetylhydrolase, 1-alkyl-2-acetylglycerophosphocholine esterase, 2-acetyl-1-alkylglycerophosphocholine esterase, Group-VIIA phospholipase A2, LDL-associated phospholipase A2, PAF 2-acylhydrolase) (AP) discontinued

Sign In for Pricing
View Details
FBXO42 Antibody
MBS859793-01 0.1 mg

FBXO42 Antibody

Sign In for Pricing
View Details
FBXO42 Antibody
MBS859793-02 0.1 mL (AF405L)

FBXO42 Antibody

Sign In for Pricing
View Details