Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3), partial

This Recombinant Mouse Deoxyribonuclease gamma (Dnase1l3), partial spans the amino acid sequence from region 26-287aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2; Deoxyribonuclease I-like 3; DNase I-like 3; Liver and spleen DNase; LS-DNase; LSD

UniProt

O55070

Expression Region

26-287aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRLCSFNVRSFGASKKENHEAMDIIVKIIKRCDLILLMEIKDSSNNICPMLMEKLNGNSRRSTTYNYVISSRLGRNTYKEQYAFVYKEKLVSVKTKYHYHDYQDGDTDVFSREPFVVWFHSPFTAVKDFVIVPLHTTPETSVKEIDELVDVYTDVRSQWKTENFIFMGDFNAGCSYVPKKAWQNIRLRTDPKFVWLIGDQEDTTVKKSTSCAYDRIVLCGQEIVNSVVPRSSGVFDFQKAYDLSEEEALDVSDHFPVEFKLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Borrelia Afzelii fliW Protein (aa 1-132)
VAng-Lsx1619-1mgEcoli 1 mg (E. coli)

Recombinant Borrelia Afzelii fliW Protein (aa 1-132)

Sign In for Pricing
View Details
RGD1561795 3'UTR Luciferase Stable Cell Line
TU218455 1.0 mL

RGD1561795 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
neurolysin Double Nickase Plasmid (h)
sc-407327-NIC 20 µg

neurolysin Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Ifi35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7360808 1.0 µg DNA

Ifi35 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human Complement Factor P ELISA Kit
MBS3803986-01 48 Well

Human Complement Factor P ELISA Kit

Sign In for Pricing
View Details
Human Complement Factor P ELISA Kit
MBS3803986-02 96 Well

Human Complement Factor P ELISA Kit

Sign In for Pricing
View Details