Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella typhimurium Major outer membrane lipoprotein Lpp 1 (lpp1)

This Recombinant Salmonella typhimurium Major outer membrane lipoprotein Lpp 1 (lpp1) spans the amino acid sequence from region 21-78aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Braun lipoprotein 1; BLP 1; Murein lipoprotein 1

UniProt

Q7CQN4

Expression Region

21-78aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

Field of Research

Infectious Disease & Virology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNQATKYRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia pseudotuberculosis serotype IB DNA mismatch repair protein mutL (mutL), partial
MBS1155679 Inquire

Recombinant Yersinia pseudotuberculosis serotype IB DNA mismatch repair protein mutL (mutL), partial

Sign In for Pricing
View Details
VOM2R40 Adenovirus (Rat)
50119056 1.0 mL

VOM2R40 Adenovirus (Rat)

Sign In for Pricing
View Details
1,3-Adamantanediol
sc-222907 5 g

1,3-Adamantanediol

Sign In for Pricing
View Details
Human Interleukin 5 Receptor Alpha (IL5Ra) ELISA Kit
orb777828-01 48 Tests

Human Interleukin 5 Receptor Alpha (IL5Ra) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 5 Receptor Alpha (IL5Ra) ELISA Kit
orb777828-02 96 Tests

Human Interleukin 5 Receptor Alpha (IL5Ra) ELISA Kit

Sign In for Pricing
View Details
Cy3 Conjugated Goat Anti-Mouse IgG
TA130012 500 µg

Cy3 Conjugated Goat Anti-Mouse IgG

Sign In for Pricing
View Details