Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vascular endothelial growth factor A (VEGFA)

This Recombinant Human Vascular endothelial growth factor A (VEGFA) spans the amino acid sequence from region 27-232aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VEGF-A; Vascular permeability factor; VPF

UniProt

P15692

Expression Region

27-232aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research; Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TNFRSF8 (cAC10)-Mc-VC-PABC-MMAE ADC
ADC-W-344 1 mg

Anti-TNFRSF8 (cAC10)-Mc-VC-PABC-MMAE ADC

Sign In for Pricing
View Details
Rat Monoclonal BCMA/TNFRSF17 Antibody (Vicky-1) [DyLight 594]
NBP1-97637DL594 0.1 mL

Rat Monoclonal BCMA/TNFRSF17 Antibody (Vicky-1) [DyLight 594]

Sign In for Pricing
View Details
CHEK1 Antibody
orb1562953-01 20 ul

CHEK1 Antibody

Sign In for Pricing
View Details
CHEK1 Antibody
orb1562953-02 50 µL

CHEK1 Antibody

Sign In for Pricing
View Details
CHEK1 Antibody
orb1562953-03 100 µL

CHEK1 Antibody

Sign In for Pricing
View Details
PF-06650833 25mg
A17187-25 25 mg

PF-06650833 25mg

Sign In for Pricing
View Details