Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Cystatin-C (CST3)

This Recombinant Bovine Cystatin-C (CST3) spans the amino acid sequence from region 31-148aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Colostrum thiol proteinase inhibitor; Cystatin-3

UniProt

P01035

Expression Region

31-148aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGPRKGRLLGGLMEADVNEEGVQEALSFAVSEFNKRSNDAYQSRVVRVVRARKQVVSGMNYFLDVELGRTTCTKSQANLDSCPFHNQPHLKREKLCSFQVYVVPWMNTINLVKFSCQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor VIII (F8) Human Gene Knockout Kit (CRISPR)
KN419116 1 Kit

Factor VIII (F8) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human LAYN activation kit by CRISPRa
GA115475 1 Kit

Human LAYN activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS636968 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
COPG (COPG1) (NM_016128) Human Recombinant Protein
TP309018 20 µg

COPG (COPG1) (NM_016128) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS637262 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
SCO2 Recombinant Rabbit monoclonal Antibody
HA723166 100 µL

SCO2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details