Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Cystatin-C (CST3)

This Recombinant Bovine Cystatin-C (CST3) spans the amino acid sequence from region 31-148aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Colostrum thiol proteinase inhibitor; Cystatin-3

UniProt

P01035

Expression Region

31-148aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGPRKGRLLGGLMEADVNEEGVQEALSFAVSEFNKRSNDAYQSRVVRVVRARKQVVSGMNYFLDVELGRTTCTKSQANLDSCPFHNQPHLKREKLCSFQVYVVPWMNTINLVKFSCQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENND4C Human Gene Knockout Kit (CRISPR)
KN419039 1 Kit

DENND4C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAD52 Rabbit Monoclonal Antibody
TA423749 100 µL

RAD52 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Akt (Ab-246) Antibody
8B0608-AAT 50 µg

Akt (Ab-246) Antibody

Sign In for Pricing
View Details
Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI4A10]
CF805891 100 µg

Centrin 3 (CETN3) Mouse Monoclonal Antibody [Clone ID: OTI4A10]

Sign In for Pricing
View Details
SynCAM (CADM1) (NM_014333) Human Over-expression Lysate
LY402316 100 µg

SynCAM (CADM1) (NM_014333) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45 / LCA (2B11), CF647 conjugate, 0.1mg/mL
BNC470470-500 1x 500 µL

CD45 / LCA (2B11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details