Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Cystatin-C (CST3)

This Recombinant Bovine Cystatin-C (CST3) spans the amino acid sequence from region 31-148aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Colostrum thiol proteinase inhibitor; Cystatin-3

UniProt

P01035

Expression Region

31-148aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Cardiovascular Research

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QGPRKGRLLGGLMEADVNEEGVQEALSFAVSEFNKRSNDAYQSRVVRVVRARKQVVSGMNYFLDVELGRTTCTKSQANLDSCPFHNQPHLKREKLCSFQVYVVPWMNTINLVKFSCQD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromodeoxyuridine (BrdU) (Proliferation Marker) (BRD/1539R), 0.2mg/mL
BNUB1539-100 1x 100 µL

Bromodeoxyuridine (BrdU) (Proliferation Marker) (BRD/1539R), 0.2mg/mL

Sign In for Pricing
View Details
Human EIF4B activation kit by CRISPRa
GA101368 1 Kit

Human EIF4B activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701643 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
TEX11 Antibody
OC-2149-01 50 μL

TEX11 Antibody

Sign In for Pricing
View Details
TEX11 Antibody
OC-2149-02 100 µL

TEX11 Antibody

Sign In for Pricing
View Details
TEX11 Antibody
OC-2149-03 1 mL

TEX11 Antibody

Sign In for Pricing
View Details