Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Large T antigen, partial

This Recombinant BK polyomavirus Large T antigen, partial spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LT; LT-AG

UniProt

P03071

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged and C-terminal Avi-tagged

Source

E.coli

Origin

BK polyomavirus (BKPyV) (Human polyomavirus 1)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVPTYGTEEWESWWSSFNEKWDEDLFCHEDMFASDEEATADSQHSTPPKKKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesothelin Antibody FITC Conjugated
orb1543699 100 µL

Mesothelin Antibody FITC Conjugated

Sign In for Pricing
View Details
Mouse Notch3 qPCR Primer Pair
QM04202S 200 Tests

Mouse Notch3 qPCR Primer Pair

Sign In for Pricing
View Details
O412
B1150-50 50 mg

O412

Sign In for Pricing
View Details
Gephyrin/GPHN Rabbit Polyclonal Antibody (FITC)
orb2600657 100 µg

Gephyrin/GPHN Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
CD272 Polyclonal Antibody
MBS9419798-01 0.05 mL

CD272 Polyclonal Antibody

Sign In for Pricing
View Details
CD272 Polyclonal Antibody
MBS9419798-02 0.1 mL

CD272 Polyclonal Antibody

Sign In for Pricing
View Details