Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Large T antigen, partial

This Recombinant BK polyomavirus Large T antigen, partial spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LT; LT-AG

UniProt

P03071

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged and C-terminal Avi-tagged

Source

E.coli

Origin

BK polyomavirus (BKPyV) (Human polyomavirus 1)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVPTYGTEEWESWWSSFNEKWDEDLFCHEDMFASDEEATADSQHSTPPKKKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ETNK2 Polyclonal Antibody, PE Conjugated
bs-13112R-PE 100 µL

ETNK2 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
p130 Polyclonal Antibody
JOT-AP06740-01 20 µL

p130 Polyclonal Antibody

Sign In for Pricing
View Details
p130 Polyclonal Antibody
JOT-AP06740-02 50 μL

p130 Polyclonal Antibody

Sign In for Pricing
View Details
p130 Polyclonal Antibody
JOT-AP06740-03 100 µL

p130 Polyclonal Antibody

Sign In for Pricing
View Details
Human AP 4 complex subunit epsilon 1 (AP4E1) ELISA Kit
MBS7232066-01 48 Well

Human AP 4 complex subunit epsilon 1 (AP4E1) ELISA Kit

Sign In for Pricing
View Details
Human AP 4 complex subunit epsilon 1 (AP4E1) ELISA Kit
MBS7232066-02 96 Well

Human AP 4 complex subunit epsilon 1 (AP4E1) ELISA Kit

Sign In for Pricing
View Details