Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Puumala virus Envelope glycoprotein (GP), partial

This Recombinant Puumala virus Envelope glycoprotein (GP), partial spans the amino acid sequence from region 1-275aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M polyprotein; Gc; Glycoprotein G2

UniProt

P41264

Expression Region

1-275aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Puumala virus (strain Berkel)

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CIQLGTEQTCKSVDSNDCLVTTSVKVCLIGTVSKFQPSDTLLFLGPLEQGGLIFKQWCTTTCQFGDPGDIMSTPVGMKCPELSGSFRKKCAFATTPVCQFDGNTISGYKRMIATKDSFQSFNVTEPHISASSLEWIDPDSSLRDHINVIVGRDLSFQDLSETPCQVDLTTTSIDGAWGSGVGFNLICSVSLTECSTFLTSIKACDSAMCYGSTTANLLRGQNTVHIVGKGGHSGSKFMCCHDTKCSSTGLIAAAPHLDRVTGYNQADSDKIFDDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Acetylcholinesterase Antibody ELISA Kit
MBS047297 Inquire

Cavy Acetylcholinesterase Antibody ELISA Kit

Sign In for Pricing
View Details
Tetrahydrocannabinol (THC) Antibody
abx024237 1 mg

Tetrahydrocannabinol (THC) Antibody

Sign In for Pricing
View Details
Neurofilament (H+L) (Neuronal Marker) Antibody
orb1410444-01 20 µg

Neurofilament (H+L) (Neuronal Marker) Antibody

Sign In for Pricing
View Details
Neurofilament (H+L) (Neuronal Marker) Antibody
orb1410444-02 100 µg

Neurofilament (H+L) (Neuronal Marker) Antibody

Sign In for Pricing
View Details
Neurofilament (H+L) (Neuronal Marker) Antibody
orb1410444-03 100 ug (without BSA and Azide)

Neurofilament (H+L) (Neuronal Marker) Antibody

Sign In for Pricing
View Details
Anti-Eml2 Rabbit pAb
GB114699-50 50 μL

Anti-Eml2 Rabbit pAb

Sign In for Pricing
View Details