Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich repeat LGI family member 2 (LGI2)

This Recombinant Human Leucine-rich repeat LGI family member 2 (LGI2) spans the amino acid sequence from region 29-545aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LGI1-like protein 2; Leucine-rich glioma-inactivated protein 2

UniProt

Q8N0V4

Expression Region

29-545aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QVRRLARCPATCSCTKESIICVGSSWVPRIVPGDISSLSLVNGTFSEIKDRMFSHLPSLQLLLLNSNSFTIIRDDAFAGLFHLEYLFIEGNKIETISRNAFRGLRDLTHLSLANNHIKALPRDVFSDLDSLIELDLRGNKFECDCKAKWLYLWLKMTNSTVSDVLCIGPPEYQEKKLNDVTSFDYECTTTDFVVHQTLPYQSVSVDTFNSKNDVYVAIAQPSMENCMVLEWDHIEMNFRSYDNITGQSIVGCKAILIDDQVFVVVAQLFGGSHIYKYDESWTKFVKFQDIEVSRISKPNDIELFQIDDETFFVIADSSKAGLSTVYKWNSKGFYSYQSLHEWFRDTDAEFVDIDGKSHLILSSRSQVPIILQWNKSSKKFVPHGDIPNMEDVLAVKSFRMQNTLYLSLTRFIGDSRVMRWNSKQFVEIQALPSRGAMTLQPFSFKDNHYLALGSDYTFSQIYQWDKEKQLFKKFKEIYVQAPRSFTAVSTDRRDFFFASSFKGKTKIFEHIIVDLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon
CB508174 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
KDEL Receptor (KDELR1) (NM_006801) Human Recombinant Protein
TP305880 20 µg

KDEL Receptor (KDELR1) (NM_006801) Human Recombinant Protein

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF568 conjugate, 0.1mg/mL
BNC682576-500 1x 500 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2576), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LIPF (NM_004190) Human Over-expression Lysate
LC401348 20 µg

LIPF (NM_004190) Human Over-expression Lysate

Sign In for Pricing
View Details
Glypican-3 (GPC3/863), CF647 conjugate, 0.1mg/mL
BNC470863-100 1x 100 µL

Glypican-3 (GPC3/863), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SOCS2 Antibody
RC-4700-01 50 μL

Recombinant SOCS2 Antibody

Sign In for Pricing
View Details