Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Sialate O-acetylesterase (Siae)

This Recombinant Mouse Sialate O-acetylesterase (Siae) spans the amino acid sequence from region 24-275aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sialic acid-specific 9-O-acetylesterase; Yolk sac protein 2

UniProt

P70665

Expression Region

24-275aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Disease Biomarkers

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGFRFASYIDNYMVLQKEPSGAVIWGFGTPGATVTVTLCQGQETIMKKVTSVKEPSNTWMVVLDPMKPGGPFEVMAQQTLGTMNFTLRVHDVLFGDVWLCSGQSNMQMTVSQIFNASKELSDTAAYQSVRIFSVSLIQSEEELDDLTEVDLSWSKPTAGNLGHGNFTYMSAVCWLFGRYLYDTLQYPIGLVSSSWGGTYIEVWSSRRTLKACGVPNTRDERVGQPEIKPMRNECNSEESSCPFRVVPSVRVT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human soluble CD5 ELISA Kit
EK5538 96 Tests

Human soluble CD5 ELISA Kit

Sign In for Pricing
View Details
Anti-PRL Antibody
STJ502655 100 µg

Anti-PRL Antibody

Sign In for Pricing
View Details
GAPDH Antibody
MBS7122577-01 0.05 mg

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
MBS7122577-02 0.1 mg

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
MBS7122577-03 5x 0.1 mg

GAPDH Antibody

Sign In for Pricing
View Details
Srrt Antibody
E38QA9936 100 µL

Srrt Antibody

Sign In for Pricing
View Details