Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ig gamma-2A chain C region secreted form

This Recombinant Mouse Ig gamma-2A chain C region secreted form spans the amino acid sequence from region 1-335aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B allele

UniProt

P01864

Expression Region

1-335aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRVPITQNPCPPHQRVPPCAAPDLLGGPSVFIFPPKIKDVLMISLSPMVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNRALPSPIEKTISKPRGPVRAPQVYVLPPPAEEMTKKEFSLTCMITGFLPAEIAVDWTSNGRTEQNYKNTATVLDSDGSYFMYSKLRVQKSTWERGSLFACSVVHEVLHNHLTTKTISRSLGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EA-89-Succinic acid
T201438-01 10 mg

EA-89-Succinic acid

Sign In for Pricing
View Details
EA-89-Succinic acid
T201438-02 50 mg

EA-89-Succinic acid

Sign In for Pricing
View Details
Recombinant Cercocarpus betuloides Maturase K (matK), partial
MBS1357502 Inquire

Recombinant Cercocarpus betuloides Maturase K (matK), partial

Sign In for Pricing
View Details
14-3-3 beta Rabbit pAb, BF647 conjugated
orb3001969 100 µL

14-3-3 beta Rabbit pAb, BF647 conjugated

Sign In for Pricing
View Details
Rat Ola1 Pre-designed siRNA Set B
SI209758B 1 Each

Rat Ola1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
OR7E85P AAV siRNA Pooled Vector
35627161 1.0 µg

OR7E85P AAV siRNA Pooled Vector

Sign In for Pricing
View Details