Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cell surface glycoprotein CD200 receptor 1 (CD200R1), partial

This Recombinant Human Cell surface glycoprotein CD200 receptor 1 (CD200R1), partial spans the amino acid sequence from region 226-325aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD200 cell surface glycoprotein receptor; Cell surface glycoprotein OX2 receptor 1

UniProt

Q8TD46

Expression Region

226-325aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLYIELLPVPGAKKSAKLYIPYIILTIIILTIVGFIWLLKVNGCRKYKLNKTESTPVVEEDEMQPYASYTEKNNPLYDTTNKVKASEALQSEVDTDLHTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha Adducin (ADD1) (NM_001119) Human Over-expression Lysate
LY420118 100 µg

alpha Adducin (ADD1) (NM_001119) Human Over-expression Lysate

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), Biotin conjugate, 0.1mg/mL
BNCB0352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aryl hydrocarbon Receptor (AHR) Human Gene Knockout Kit (CRISPR)
KN209832RB 1 Kit

Aryl hydrocarbon Receptor (AHR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GNPTG (NM_032520) Human Over-expression Lysate
LC403165 20 µg

GNPTG (NM_032520) Human Over-expression Lysate

Sign In for Pricing
View Details
Eph receptor B1 (EPHB1) Mouse Monoclonal Antibody [Clone ID: 5F10A4]
AM06214SU-N 100 µL

Eph receptor B1 (EPHB1) Mouse Monoclonal Antibody [Clone ID: 5F10A4]

Sign In for Pricing
View Details
MitoLite™ Orange FX570
22676-AAT 500 Tests

MitoLite™ Orange FX570

Sign In for Pricing
View Details