Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacteria phage Qbeta Coat protein

This Recombinant Enterobacteria phage Qbeta Coat protein spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CP; Coat protein

UniProt

P03615

Expression Region

1-133aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia virus Qbeta (Bacteriophage Q-beta)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD2 Human Gene Knockout Kit (CRISPR)
KN224760RB 1 Kit

SETD2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pla2g10 (BC028879) Mouse Tagged ORF Clone
MG200952 10 µg

Pla2g10 (BC028879) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Eph receptor A4 (EPHA4) Mouse Monoclonal Antibody [Clone ID: 7D3D4]
AM06240SU-N 100 µL

Eph receptor A4 (EPHA4) Mouse Monoclonal Antibody [Clone ID: 7D3D4]

Sign In for Pricing
View Details
BCL-10 (BL10/411), 1mg/mL
BNUM0411-50 1x 50 µL

BCL-10 (BL10/411), 1mg/mL

Sign In for Pricing
View Details
NELL2 Mouse Monoclonal Antibody [Clone ID: AT13E7]
AM09386PU-N 100 µL

NELL2 Mouse Monoclonal Antibody [Clone ID: AT13E7]

Sign In for Pricing
View Details
KLHL11 Mouse Monoclonal Antibody [Clone ID: 1B9C1]
AM06477SU-N 100 µL

KLHL11 Mouse Monoclonal Antibody [Clone ID: 1B9C1]

Sign In for Pricing
View Details