Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Succinate receptor 1 (SUCNR1)

This Recombinant Human Succinate receptor 1 (SUCNR1) spans the amino acid sequence from region 1-334. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G-protein coupled receptor 91; P2Y purinoceptor 1-like

UniProt

Q9BXA5

Expression Region

1-334aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLGIMAWNATCKNWLAAEAALEKYYLSIFYGIEFVVGVLGNTIVVYGYIFSLKNWNSSNIYLFNLSVSDLAFLCTLPMLIRSYANGNWIYGDVLCISNRYVLHANLYTSILFLTFISIDRYLIIKYPFREHLLQKKEFAILISLAIWVLVTLELLPILPLINPVITDNGTTCNDFASSGDPNYNLIYSMCLTLLGFLIPLFVMCFFYYKIALFLKQRNRQVATALPLEKPLNLVIMAVVIFSVLFTPYHVMRNVRIASRLGSWKQYQCTQVVINSFYIVTRPLAFLNSVINPVFYFLLGDHFRDMLMNQLRHNFKSLTSFSRWAHELLLSFREK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Cholera Toxin (CTB) Mab
111195 100 µg

Anti Cholera Toxin (CTB) Mab

Sign In for Pricing
View Details
ZNF696 Antibody - N-terminal region
ARP36061_P050-25UL 25 µL

ZNF696 Antibody - N-terminal region

Sign In for Pricing
View Details
LRRC68, NT (PPP1R37, KIAA1986, LRRC68, Protein phosphatase 1 regulatory subunit 37, Leucine-rich repeat-containing protein 68) (AP) discontinued
037971-AP 200 µL

LRRC68, NT (PPP1R37, KIAA1986, LRRC68, Protein phosphatase 1 regulatory subunit 37, Leucine-rich repeat-containing protein 68) (AP) discontinued

Sign In for Pricing
View Details
CCR5 (phospho-S349) peptide
orb339350-01 1 mg

CCR5 (phospho-S349) peptide

Sign In for Pricing
View Details
CCR5 (phospho-S349) peptide
orb339350-02 5 mg

CCR5 (phospho-S349) peptide

Sign In for Pricing
View Details
IRF2 AAV Vector (Rat) (CMV)
25078106 1 µg

IRF2 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details