Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mesocricetus auratus Interferon alpha/beta receptor 1 (Ifnar1), partial

This Recombinant Mesocricetus auratus Interferon alpha/beta receptor 1 (Ifnar1), partial spans the amino acid sequence from region 25-431aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A3Q0CXY4

Expression Region

25-431aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mesocricetus auratus (Golden hamster)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGEELEPPEDVDVYIVDDNLTLKWSHKGEPAGNVTFSAEYQTDEMENWLKLPGCHHVTGTECEFSLLNTNIYAEMKFRVRAETGKSTSSWAEVDPFIPFLRAHIGPPGVRLEAEDQAIVVDISYPGRGGKMWEGDTLRFQYRIVIWQRSSNETKTITTSYYTIKISKLLPETTYCLKVKAIHTFRGKHSNYSAVQCINTTEASKMPVPENIEMDALGESYVLRWDCAPADVSFRAQWLPNFYKSTSGSSPDKWKPIPACADIRTMQCVFPRNTIHTDHFLLRVQAFRGNNTSFWSEEKLINSQKYTKIPPPIVAVTPTRDSLLVYVSCQDHSLSKCRKLTYEVVFWDKTSNTKRRVVKESPEFTIENLQPQTVYCVQARVLSFATWNKSSDFSDALCDATRPGNSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-NOX1-Neo Plasmid
PVT69035 2 µg

PCMV-EGFP-NOX1-Neo Plasmid

Sign In for Pricing
View Details
KCNA7 Antibody
orb1243159 100 µL

KCNA7 Antibody

Sign In for Pricing
View Details
MEK5 Rabbit Polyclonal Antibody (BF680)
orb2423673 100 µL

MEK5 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
PRL7C1 siRNA (Mouse)
CRM7212-01 15 nmol

PRL7C1 siRNA (Mouse)

Sign In for Pricing
View Details
PRL7C1 siRNA (Mouse)
CRM7212-02 30 nmol

PRL7C1 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-Mouse CD19 Monoclonal Antibody (PE Conjugated) [1D3]
MBS2557924-01 0.025 mg

Anti-Mouse CD19 Monoclonal Antibody (PE Conjugated) [1D3]

Sign In for Pricing
View Details