Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 15 (Gdf15)

This Recombinant Mouse Growth/differentiation factor 15 (Gdf15) spans the amino acid sequence from region 189-303aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDF-15; Macrophage inhibitory cytokine 1; MIC-1

UniProt

Q9Z0J7

Expression Region

189-303aa

Tag

N-terminal hFC-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAM 5.2 Monoclonal Antibody
MBS2580096-01 1.5 mL

CAM 5.2 Monoclonal Antibody

Sign In for Pricing
View Details
CAM 5.2 Monoclonal Antibody
MBS2580096-02 3 mL

CAM 5.2 Monoclonal Antibody

Sign In for Pricing
View Details
CAM 5.2 Monoclonal Antibody
MBS2580096-03 6 mL

CAM 5.2 Monoclonal Antibody

Sign In for Pricing
View Details
CAM 5.2 Monoclonal Antibody
MBS2580096-04 5x 6 mL

CAM 5.2 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Shewanella halifaxensis Isoleucine--tRNA ligase (ileS), partial
MBS1196131 Inquire

Recombinant Shewanella halifaxensis Isoleucine--tRNA ligase (ileS), partial

Sign In for Pricing
View Details
Recombinant Brucella Abortus panB Protein (aa 1-275)
VAng-Lsx5137-1mgEcoli 1 mg (E. coli)

Recombinant Brucella Abortus panB Protein (aa 1-275)

Sign In for Pricing
View Details