Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth/differentiation factor 15 (Gdf15)

This Recombinant Mouse Growth/differentiation factor 15 (Gdf15) spans the amino acid sequence from region 189-303aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GDF-15; Macrophage inhibitory cytokine 1; MIC-1

UniProt

Q9Z0J7

Expression Region

189-303aa

Tag

N-terminal hFC-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAHAHPRDSCPLGPGRCCHLETVQATLEDLGWSDWVLSPRQLQLSMCVGECPHLYRSANTHAQIKARLHGLQPDKVPAPCCVPSSYTPVVLMHRTDSGVSLQTYDDLVARGCHCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Sulfate Heptahydrate
37011-91 1 g

Zinc Sulfate Heptahydrate

Sign In for Pricing
View Details
ZFP112 Adenovirus (Rat)
50841056 1.0 mL

ZFP112 Adenovirus (Rat)

Sign In for Pricing
View Details
ATP2A1 Protein Vector (Mouse) (pPM-C-His)
PV157229 500 ng

ATP2A1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
VEGFD/FIGF Rabbit Polyclonal Antibody (FITC)
orb2618576 100 µg

VEGFD/FIGF Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
LG 100268 10mg
A14127-10 10 mg

LG 100268 10mg

Sign In for Pricing
View Details
Tetraethyl Orthocarbonate
166759 10 g

Tetraethyl Orthocarbonate

Sign In for Pricing
View Details