Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 subunit alpha (IL12A)

This Recombinant Human Interleukin-12 subunit alpha (IL12A) spans the amino acid sequence from region 23-219aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-12A; Cytotoxic lymphocyte maturation factor 35 kDa subunit; CLMF p35; IL-12 subunit p35; NK cell stimulatory factor chain 1; NKSF1

UniProt

P29459

Expression Region

23-219aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (Biotin)
MBS6145414-01 0.1 mL

GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (Biotin)

Sign In for Pricing
View Details
GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (Biotin)
MBS6145414-02 5x 0.1 mL

GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (Biotin)

Sign In for Pricing
View Details
5,7,8-Trihydroxyflavone
FT65533-01 2 mg

5,7,8-Trihydroxyflavone

Sign In for Pricing
View Details
5,7,8-Trihydroxyflavone
FT65533-02 5 mg

5,7,8-Trihydroxyflavone

Sign In for Pricing
View Details
Recombinant Rat Interferon-induced transmembrane protein 3 (ifitm3)
orb2903179-01 20 µg

Recombinant Rat Interferon-induced transmembrane protein 3 (ifitm3)

Sign In for Pricing
View Details
Recombinant Rat Interferon-induced transmembrane protein 3 (ifitm3)
orb2903179-02 100 µg

Recombinant Rat Interferon-induced transmembrane protein 3 (ifitm3)

Sign In for Pricing
View Details