Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon regulatory factor 1 (Irf1)

This Recombinant Mouse Interferon regulatory factor 1 (Irf1) spans the amino acid sequence from region 1-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IRF-1

UniProt

P15314

Expression Region

1-329aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDITPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CPPED1 Protein, His, E.coli-1mg
QP11497-1mg 1mg

Recombinant Human CPPED1 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
KIAA0664 Protein Vector (Human) (pPM-C-His)
PV088853 500 ng

KIAA0664 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human Growth Hormone Releasing Hormone GRH ELISA Kit
BG-HUM10982 1 Each

Human Growth Hormone Releasing Hormone GRH ELISA Kit

Sign In for Pricing
View Details
TP53 Antibody - middle region
ARP97250_P050-25UL 25 µL

TP53 Antibody - middle region

Sign In for Pricing
View Details
PEX10 Polyclonal Antibody, Cy7 Conjugated
bs-0355R-Cy7 100 µL

PEX10 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
NAT11 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV813397 1.0 µg DNA

NAT11 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details