Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interferon regulatory factor 1 (Irf1)

This Recombinant Mouse Interferon regulatory factor 1 (Irf1) spans the amino acid sequence from region 1-329aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IRF-1

UniProt

P15314

Expression Region

1-329aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQRKERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDITPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMKLFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMKNMDSIMWMDSLLGNSVRLPPSIQAIPCAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Locusta migratoria NADH-ubiquinone oxidoreductase chain 4L (ND4L), partial
MBS7078251 Inquire

Recombinant Locusta migratoria NADH-ubiquinone oxidoreductase chain 4L (ND4L), partial

Sign In for Pricing
View Details
Polystyrene A REM
HA16020018.5G 5 g

Polystyrene A REM

Sign In for Pricing
View Details
Anti-KCNIP3 Polyclonal Antibody
PHJ86701 100 μg

Anti-KCNIP3 Polyclonal Antibody

Sign In for Pricing
View Details
RIC8B sgRNA CRISPR Lentivector (Human) (Target 3)
K1823204 1.0 µg DNA

RIC8B sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cobalt Sulphate Heptahydrate (Cobalt (II) Sulphate)
1031760 100 100 g

Cobalt Sulphate Heptahydrate (Cobalt (II) Sulphate)

Sign In for Pricing
View Details
Omt2b Mouse shRNA Plasmid (Locus ID 382088)
TR508651 1 Kit

Omt2b Mouse shRNA Plasmid (Locus ID 382088)

Sign In for Pricing
View Details