Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Midkine (Mdk)

This Recombinant Mouse Midkine (Mdk) spans the amino acid sequence from region 23-140aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MK; Retanoic acid-responsive protein; Retinoic acid-induced differentiation factor

UniProt

P12025

Expression Region

23-140aa

Tag

N-terminal 10xHis-EGFP-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YbjT Antibody
orb830052 2 mg

YbjT Antibody

Sign In for Pricing
View Details
Lentiviral human SOX8 shRNA (UAS) - Lentiviral human SOX8 shRNA (UAS) plasmid
GTR15079783 1 Vial

Lentiviral human SOX8 shRNA (UAS) - Lentiviral human SOX8 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Leptin receptor Rabbit Polyclonal Antibody (FITC)
orb9160 100 µL

Leptin receptor Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Canine Early Growth Response Protein 4 ELISA Kit
MBS008214-01 48 Well

Canine Early Growth Response Protein 4 ELISA Kit

Sign In for Pricing
View Details
Canine Early Growth Response Protein 4 ELISA Kit
MBS008214-02 96 Well

Canine Early Growth Response Protein 4 ELISA Kit

Sign In for Pricing
View Details
Canine Early Growth Response Protein 4 ELISA Kit
MBS008214-03 5x 96 Well

Canine Early Growth Response Protein 4 ELISA Kit

Sign In for Pricing
View Details