Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Brain-derived neurotrophic factor (BDNF)

This Recombinant Dog Brain-derived neurotrophic factor (BDNF) spans the amino acid sequence from region 129-247aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BDNF; ProBDNF

UniProt

Q7YRB4

Expression Region

129-247aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[RM4-4]
AN00417P-01 50 Tests

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[RM4-4]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[RM4-4]
AN00417P-02 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[RM4-4]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[RM4-4]
AN00417P-03 2x 100 Tests

PE/Elab Fluor® 594 Anti-Mouse CD4 Antibody[RM4-4]

Sign In for Pricing
View Details
Human ERAS activation kit by CRISPRa
GA102232 1 Kit

Human ERAS activation kit by CRISPRa

Sign In for Pricing
View Details
FKBP12 (FKBP1A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]
TA500557AM 100 µL

FKBP12 (FKBP1A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B3]

Sign In for Pricing
View Details
CMV-p65 (CMV101), 0.2mg/mL
BNUB0101-500 1x 500 µL

CMV-p65 (CMV101), 0.2mg/mL

Sign In for Pricing
View Details