Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dickkopf-related protein 4 (Dkk4)

This Recombinant Mouse Dickkopf-related protein 4 (Dkk4) spans the amino acid sequence from region 19-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dickkopf-4; Dkk-4

UniProt

Q8VEJ3

Expression Region

19-221aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDERSFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPGLTCRSQVTSNRQHSRLRVCQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human 4-hydroxyphenylpyruvate dioxygenase polyclonal Antibody, Biotin conjugated
MBS1489913-01 0.05 mg

Rabbit anti-human 4-hydroxyphenylpyruvate dioxygenase polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human 4-hydroxyphenylpyruvate dioxygenase polyclonal Antibody, Biotin conjugated
MBS1489913-02 0.1 mg

Rabbit anti-human 4-hydroxyphenylpyruvate dioxygenase polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human 4-hydroxyphenylpyruvate dioxygenase polyclonal Antibody, Biotin conjugated
MBS1489913-03 5x 0.1 mg

Rabbit anti-human 4-hydroxyphenylpyruvate dioxygenase polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)
MBS6338492-01 0.2 mL

PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)

Sign In for Pricing
View Details
PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)
MBS6338492-02 5x 0.2 mL

PTEN, CT (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (APC)

Sign In for Pricing
View Details
Tubulin Folding Cofactor A (TBCA) Antibody
abx124414-01 100 µL

Tubulin Folding Cofactor A (TBCA) Antibody

Sign In for Pricing
View Details