Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Dickkopf-related protein 4 (Dkk4)

This Recombinant Mouse Dickkopf-related protein 4 (Dkk4) spans the amino acid sequence from region 19-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dickkopf-4; Dkk-4

UniProt

Q8VEJ3

Expression Region

19-221aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDERSFCATCRRVRRRCQRSAVCCPGTVCVNDVCTAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENRPQGKPSTKKSQSSKGQEGESCLRTSDCGPGLCCARHFWTKICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPGLTCRSQVTSNRQHSRLRVCQRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[KO Validated] IL6ST Rabbit pAb
E45R29600N 50 ul

[KO Validated] IL6ST Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal BRIX Antibody [Janelia Fluor 646]
NBP2-99257JF646 0.1 mL

Rabbit Polyclonal BRIX Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
C14orf41 AAV siRNA Pooled Vector
53609161 1.0 µg

C14orf41 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Olr470 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7383507 1.0 µg DNA

Olr470 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Bovine P2X Purinoceptor 3 (P2RX3) ELISA Kit
OM620526 96 Strip Well

Bovine P2X Purinoceptor 3 (P2RX3) ELISA Kit

Sign In for Pricing
View Details
pUC18 Plasmid
PVT0001 2 µg

pUC18 Plasmid

Sign In for Pricing
View Details