Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Y-box-binding protein 3 (YBX3)

This Recombinant Human Y-box-binding protein 3 (YBX3) spans the amino acid sequence from region 2-372aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cold shock domain-containing protein A; DNA-binding protein A; Single-strand DNA-binding protein NF-GMB

UniProt

P16989

Expression Region

2-372aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPC1 antibody
FNab05812 100 µg

NPC1 antibody

Sign In for Pricing
View Details
PE anti-mouse CD11c
E16FMP011c-200U 200 µg

PE anti-mouse CD11c

Sign In for Pricing
View Details
Ppp3r2 (NM_021701) Rat Tagged Lenti ORF Clone
RR215100L3 10 µg

Ppp3r2 (NM_021701) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Upstream Binding Protein 1 (UBP1) Human Over-expression Lysate
orb1341090 100 µg

Upstream Binding Protein 1 (UBP1) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfp516 (NM_183033) Mouse Tagged Lenti ORF Clone
MR224195L3 10 µg

Zfp516 (NM_183033) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Simian virus 5 RNA-directed RNA polymerase L (L), partial
MBS1474539 Inquire

Recombinant Simian virus 5 RNA-directed RNA polymerase L (L), partial

Sign In for Pricing
View Details