Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant BK polyomavirus Large T antigen, partial, Biotinylated

This Recombinant BK polyomavirus Large T antigen, partial, Biotinylated spans the amino acid sequence from region 1-133aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LT; LT-AG

UniProt

P03071

Expression Region

1-133aa

Tag

N-terminal 6xHis-SUMO3-Avi-tagged

Source

E.coli

Origin

BK polyomavirus (BKPyV) (Human polyomavirus 1)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVPTYGTEEWESWWSSFNEKWDEDLFCHEDMFASDEEATADSQHSTPPKKKRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-(-)-2-Amino-1-propanol
TRC-A628145-5G 5 g

(R)-(-)-2-Amino-1-propanol

Sign In for Pricing
View Details
Recombinant Human REG3G/PAP-1B Protein (His Tag)
PKSH032990-01 10 µg

Recombinant Human REG3G/PAP-1B Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human REG3G/PAP-1B Protein (His Tag)
PKSH032990-02 50 µg

Recombinant Human REG3G/PAP-1B Protein (His Tag)

Sign In for Pricing
View Details
Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2468), CF568 conjugate, 0.1mg/mL
BNC682468-500 1x 500 µL

Perforin-1 (Pore Forming Protein) (Apoptosis Marker) (PRF1/2468), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5HT1E Receptor (HTR1E) Rabbit Polyclonal Antibody
AP20469PU-N 100 µg

5HT1E Receptor (HTR1E) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BTBD15 (ZBTB44) (NM_001301098) Human Tagged ORF Clone
RG238933 10 µg

BTBD15 (ZBTB44) (NM_001301098) Human Tagged ORF Clone

Sign In for Pricing
View Details