Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES)

This Recombinant Ehrlichia chaffeensis Co-chaperonin GroES (groES) spans the amino acid sequence from region 1-94aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

10 kDa chaperonin; Chaperonin-10; Cpn10

UniProt

P42386

Expression Region

1-94aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Ehrlichia chaffeensis

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNLNMLHDNVLIEALEECNSSSPIQLPDSAKKKPTQGKVVAVGPGVYNHSGNILPMTIKVGDVVFYRQWAGNEIEFHEKKYIVMKESDIIAKEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A-FABP Monoclonal Antibody
RA10728-01 50 µL

A-FABP Monoclonal Antibody

Sign In for Pricing
View Details
A-FABP Monoclonal Antibody
RA10728-02 100 µL

A-FABP Monoclonal Antibody

Sign In for Pricing
View Details
Gpx8 ORF Vector (Rat) (pORF)
ORF067852 1.0 µg DNA

Gpx8 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Chicken G-Actin (GA) ELISA Kit
MBS9388458 Inquire

Chicken G-Actin (GA) ELISA Kit

Sign In for Pricing
View Details
Telomerase Reverse Transcriptase (TERT) Antibody
abx027803-01 80 µL

Telomerase Reverse Transcriptase (TERT) Antibody

Sign In for Pricing
View Details
Telomerase Reverse Transcriptase (TERT) Antibody
abx027803-02 400 µL

Telomerase Reverse Transcriptase (TERT) Antibody

Sign In for Pricing
View Details