Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 2 (Mtco2), partial

This Recombinant Mouse Cytochrome c oxidase subunit 2 (Mtco2), partial spans the amino acid sequence from region 88-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide II

UniProt

P00405

Expression Region

88-227aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDSYMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella flexneri Cysteine protease-like VirA (virA)
CSB-EP762461SZB-01 10 µg

Recombinant Shigella flexneri Cysteine protease-like VirA (virA)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Cysteine protease-like VirA (virA)
CSB-EP762461SZB-02 50 µg

Recombinant Shigella flexneri Cysteine protease-like VirA (virA)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Cysteine protease-like VirA (virA)
CSB-EP762461SZB-03 200 µg

Recombinant Shigella flexneri Cysteine protease-like VirA (virA)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Cysteine protease-like VirA (virA)
CSB-EP762461SZB-04 500 µg

Recombinant Shigella flexneri Cysteine protease-like VirA (virA)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Cysteine protease-like VirA (virA)
CSB-EP762461SZB-05 20 µg

Recombinant Shigella flexneri Cysteine protease-like VirA (virA)

Sign In for Pricing
View Details
Recombinant Shigella flexneri Cysteine protease-like VirA (virA)
CSB-EP762461SZB-06 100 µg

Recombinant Shigella flexneri Cysteine protease-like VirA (virA)

Sign In for Pricing
View Details