Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Solute carrier family 22 member 17 (Slc22a17), partial

This Recombinant Mouse Solute carrier family 22 member 17 (Slc22a17), partial spans the amino acid sequence from region 121-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

24p3 receptor;24p3R; Brain-type organic cation transporter; Lipocalin-2 receptor

UniProt

Q9D9E0

Expression Region

121-183aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQELENTCPLPATSTFSFASLLNYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-n-Nonylphenol-2,3,5,6-d4
TRC-N650434-25MG 25 mg

4-n-Nonylphenol-2,3,5,6-d4

Sign In for Pricing
View Details
Mouse Cldn18 activation kit by CRISPRa
GA206002 1 Kit

Mouse Cldn18 activation kit by CRISPRa

Sign In for Pricing
View Details
TDG Recombinant Rabbit monoclonal Antibody
HA751531 100 µL

TDG Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF488A conjugate, 0.1mg/mL
BNC881807-500 1x 500 µL

CD34 (Hematopoietic Stem Cell & Endothelial Marker) (N/A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ThioStar® Thiol Detection System
L002-100UG 100 µg

ThioStar® Thiol Detection System

Sign In for Pricing
View Details
ECI2 Antibody
KC-563-01 50 μL

ECI2 Antibody

Sign In for Pricing
View Details